Case study I — an E. coli succinate cell factory#

Succinate is one of the US-DOE “top-12” bio-based platform chemicals (a precursor to biodegradable plastics, solvents and food additives), and engineering E. coli to overproduce it is a textbook metabolic-engineering problem. The classic strategy (Millard 1996; Vemuri 2002; Sánchez 2005) is: grow anaerobically and delete the competing fermentation routes so carbon is forced through PEP carboxylase / fumarate reductase to succinate.

This case runs that project end-to-end with ov.synbio on the real e_coli_core genome-scale model — from diagnosis → design → thermodynamic check → the enzyme that carries the flux → the DNA to build it.

pip install 'omicverse[synbio]'
import omicverse as ov
ov.plot_set()
m = ov.synbio.load_gem('e_coli_core')          # real BiGG genome-scale model
print(m.id, '|', len(m.reactions), 'reactions,', len(m.genes), 'genes')
🔬 Starting plot initialization...
🧬 Detecting GPU devices…
✅ NVIDIA CUDA GPUs detected: 1
    • [CUDA 0] NVIDIA H100 80GB HBM3
      Memory: 79.1 GB | Compute: 9.0

   ____            _     _    __                  
  / __ \____ ___  (_)___| |  / /__  _____________ 
 / / / / __ `__ \/ / ___/ | / / _ \/ ___/ ___/ _ \ 
/ /_/ / / / / / / / /__ | |/ /  __/ /  (__  )  __/ 
\____/_/ /_/ /_/_/\___/ |___/\___/_/  /____/\___/                                              

🔖 Version: 2.2.1rc1   📚 Tutorials: https://omicverse.readthedocs.io/
✅ plot_set complete.
e_coli_core | 95 reactions, 137 genes

1 — Diagnosis: wild-type E. coli barely secretes succinate#

On aerobic glucose the cell maximises growth and makes almost no succinate. The production envelope shows the growth-vs-succinate trade-off: at the wild-type growth optimum, succinate flux is ~0.

print('WT aerobic growth:', round(ov.synbio.fba(m).objective_value, 3), '/h')
ov.synbio.plot_production_envelope(m, 'EX_succ_e')
None
WT aerobic growth: 0.874 /h
../_images/0d816d37758490a919349386a21cdc6f57136c2764229c0bf0551d9afe164df2.png

2 — The real strategy: go anaerobic, then knock out the competition#

Cut off oxygen (EX_o2_e lower bound = 0). Now fermentation dominates, and strain_design proposes the engineering targets. FSEOF ranks over-expression targets — the enzymes that must carry more flux to make succinate; OptKnock (exact bilevel MILP via StrainDesign) proposes gene deletions that couple succinate to growth.

m_an = ov.synbio.load_gem('e_coli_core')
m_an.reactions.EX_o2_e.lower_bound = 0                       # anaerobic
sd = ov.synbio.strain_design(m_an, 'EX_succ_e', method='fseof')
print('over-express (FSEOF):', list(sd.amplify['reaction'].head(5)))
print('growth-coupled knockouts:', list(sd.knockout['reaction'].head(5)))

over-express (FSEOF): ['MDH', 'FRD7', 'SUCCt3', 'FUM', 'NADH16']
growth-coupled knockouts: ['PFL', 'FORt']

The over-expression hits — PPC (PEP carboxylase), FRD7 (fumarate reductase), FUM (fumarase), MDH (malate dehydrogenase) — are exactly the reductive-TCA enzymes that make succinate, and the knockouts hit PFL (pyruvate formate-lyase) and lactate/acetate routes — the real pflB / ldhA deletion strategy. Now confirm with the rigorous MILP:

ok = ov.synbio.strain_design(m_an, 'EX_succ_e', method='optknock',
                             max_knockouts=3, time_limit=120)
print('exact OptKnock knockout designs:')
ok.knockout.head()
exact OptKnock knockout designs:
knockouts n_knockouts
0 [GLNS] 1
1 [ICDHyr] 1
2 [RPI] 1
3 [EX_nh4_e] 1
4 [NH4t] 1

3 — Verify the design: does succinate actually go up?#

Apply a designed knockout to the anaerobic model and re-solve: knocking out pyruvate formate-lyase (PFL) forces carbon toward succinate — the guaranteed (growth-coupled) succinate flux rises from ~0.

import numpy as np
def coupled_succ(model):
    g = ov.synbio.fba(model).objective_value
    with model as mm:
        bm = [r for r in mm.reactions if r.objective_coefficient != 0][0]
        bm.lower_bound = 0.99 * g
        mm.objective = 'EX_succ_e'; mm.objective.direction = 'min'
        return ov.synbio.fba(mm).objective_value, g

s0, g0 = coupled_succ(m_an)
with m_an as mko:
    mko.reactions.PFL.knock_out()
    s1, g1 = coupled_succ(mko)
print(f'anaerobic WT : succinate {s0:.2f}  (growth {g0:.2f})')
print(f'ΔPFL strain  : succinate {s1:.2f}  (growth {g1:.2f})')
anaerobic WT : succinate 0.00  (growth 0.21)
ΔPFL strain  : succinate 0.67  (growth 0.18)

4 — Is the pathway thermodynamically feasible?#

A design is only useful if the thermodynamics allow it. reaction_dg(method='equilibrator') gives real component-contribution ΔG’° (Noor 2013); max_min_driving_force then finds the concentration-optimised driving force of the weakest step of the reductive branch (PEP → OAA → malate → fumarate → succinate).

route = {
    'PPC': {'pep': -1, 'co2': -1, 'h2o': -1, 'oaa': 1, 'pi': 1, 'h': 1},
    'MDH': {'oaa': -1, 'nadh': -1, 'h': -1, 'mal__L': 1, 'nad': 1},
    'FUM': {'mal__L': -1, 'fum': 1, 'h2o': 1},
}
dg0 = {r: ov.synbio.reaction_dg(s, method='equilibrator') for r, s in route.items()}
mdf = ov.synbio.max_min_driving_force(route, dg0, fixed={'h': 1e-7, 'h2o': 1, 'co2': 1e-4})
print('reductive-TCA ΔG\'° (kJ/mol):', {r: round(v, 1) for r, v in dg0.items()})
print('MDF =', round(mdf.mdf, 2), 'kJ/mol | feasible:', mdf.feasible, '| bottleneck:', mdf.bottleneck)
ov.synbio.plot_driving_forces(mdf)
None
reductive-TCA ΔG'° (kJ/mol): {'PPC': -40.3, 'MDH': -26.5, 'FUM': 3.4}
MDF = 14.51 kJ/mol | feasible: True | bottleneck: MDH
../_images/70d69a2d7d88affad482abefc29f31386ea329a9907e191fc2478862b0c642d0.png

5 — The enzyme that carries the flux → back to the model#

PEP carboxylase (Ppc) is the entry enzyme of the succinate branch. Its turnover number sets how much protein the cell must invest to carry that flux. Predict k_cat for Ppc with DLKcat (real trained model) on its substrate PEP, push it into an enzyme-constrained model, and see the growth cost — the A↔B hinge.

# real E. coli PEP carboxylase (Ppc) N-terminal fragment + its substrate PEP
PPC = ('MNEQYSALRSNVSMLGKVLGETIKDALGEHILERVETIRKLSKSSRAGNDANRQELLTTLQNLSNDELLPVARAFSQFL'
       'NLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPELSEDTIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNACL')
PEP = 'C(=C(/[O-])COP(=O)([O-])[O-])/C(=O)[O-]'
k = ov.synbio.enzyme_kcat(PPC, PEP, method='dlkcat', verbose=False)
print('DLKcat k_cat(Ppc, PEP) =', round(k.kcat, 3), '/s')
ecm = ov.synbio.ec_model(m, {'PPC': k.kcat})
print('growth with Ppc enzyme-constrained:', round(ov.synbio.fba(ecm).objective_value, 3), '/h')
DLKcat k_cat(Ppc, PEP) = 0.835 /s
growth with Ppc enzyme-constrained: 0.489 /h

6 — Build it: codon-optimize the over-expression target + primers#

To over-express Ppc you order a synthetic, host-optimised gene and the primers to clone it. codon_optimize rewrites it for E. coli codon usage (GC-bounded, restriction-site-free); design_primers returns validated PCR pairs.

ppc_dna = ov.synbio.codon_optimize(PPC, host='e_coli').sequence
# assemble a ppc over-expression cassette: T7 promoter + RBS + gene + T7 terminator
cassette = ('TAATACGACTCACTATAGG' + 'AAAGGAGGACAACAT' + ppc_dna
            + 'CTAGCATAACCCCTTGGGGCCTCTAAACGGGTCTTGAGGGGTTTTTTG')
print('expression cassette:', len(cassette), 'bp')
ov.synbio.view_construct(cassette, circular=True, title='ppc over-expression plasmid')
None
expression cassette: 556 bp
../_images/4b51afc20b56ff74d7b4fd3554c89f078545669229dddc923401db2d71e27563.png
# PCR primers to clone the ppc gene — shown as binding arrows on the template
primers = ov.synbio.design_primers(ppc_dna)
print('cloning primers:', primers[0])
ov.synbio.view_primers(ppc_dna, primers[0])
None
cloning primers: PrimerPair(product=134bp, Tm=60.0/60.0, L=CCATTAAAGATGCGCTGGGC, R=ATCGTTGCTCAGGTTCTGCA)
../_images/6c26ce0f81ba3870d9ca04a19d76d43e9d0bc7e5563b36819ed56dcef14b5c56.png

Summary#

In one notebook we reproduced a real succinate cell-factory design: diagnosed that wild-type E. coli can’t make succinate (production envelope), applied the real anaerobic + knock-out-the-competition strategy (strain_design FSEOF + exact OptKnock → PPC/FRD7 over-expression, PFL/lactate deletion), verified the ΔPFL strain couples succinate to growth, checked the thermodynamics of the reductive-TCA branch with real eQuilibrator ΔG + MDF, connected it to the enzyme carrying the flux (DLKcat k_cat → enzyme-constrained yield), and produced the codon-optimised gene + primers to build it — the full design-build cycle for a metabolic-engineering target, on a real GEM.